# phylogenetic-likelihood

> Phylogenetic likelihood calculations

Latest version **1.0.5** (published 2020-04-06) · ISC license · 0 weekly downloads

## Install

```sh
npm install phylogenetic-likelihood
pnpm add phylogenetic-likelihood
yarn add phylogenetic-likelihood
bun add phylogenetic-likelihood
```

## Health

**Score 15/100 (F)** — status: abandoned.

Positive: no vulnerabilities.

Warnings: low downloads; no types; no esm support.

Negative: abandoned; low maintenance score.

## Facts

| | |
|---|---|
| Version | 1.0.5 |
| Published | 2020-04-06 |
| First published | 2020-04-05 |
| Weekly downloads | 0 |
| License | ISC |
| TypeScript types | none |
| Module format | CommonJS |
| Dependencies | 1 |
| Unpacked size | 46.7 KB |
| Known vulnerabilities | 0 (+1 in 1 direct dependencies) |
| Install scripts | no |
| GitHub stars | 1 |
| Author | Ian Holmes |
| Maintainers | ihh |

## Links

- npm: https://www.npmjs.com/package/phylogenetic-likelihood
- Repository: https://github.com/ihh/phylogenetic-likelihood
- Homepage: https://github.com/ihh/phylogenetic-likelihood#readme
- Issues: https://github.com/ihh/phylogenetic-likelihood/issues
- npm.io page: https://npm.io/package/phylogenetic-likelihood

## Dependencies (1)

- [mathjs](https://npm.io/package/mathjs.md) ^6.6.2

## Recent versions

- 1.0.5 (latest) — 2020-04-06
- 1.0.4 — 2020-04-06
- 1.0.3 — 2020-04-06
- 1.0.2 — 2020-04-06
- 1.0.1 — 2020-04-05
- 1.0.0 — 2020-04-05

## README

# phylogenetic-likelihood

JavaScript implementation of phylogenetic likelihood calculations & ancestral sequence reconstruction.

~~~~
const pl = require ('phylogenetic-likelihood')

const nodeProfiles = pl.getNodePostProfiles
({ 'nodeSeq': { 'Q9DR80_9BETC': 'IGDLKCTT.VSINDVDTGVPSISTDTVDVTNGLGTYYVLDRVYLNTTLLLNGYYPTSGST',
                'E5RPZ2_9BETC': 'VGDVKCTT.IGVNDFNSGAPVISTETVDVTNGLGTYYVLDRVYLNTTLLLNGYYPTSGAN',
                'SPIKE_CVHN2':  'IGDFNCTN.SFINDYNKTIPRISEDVVDVSLGLGTYYVLNRVYLNTTLLFTGYFPKSGAN',
                'Q98341_9BETC': 'IGDFRCINLVNTDTSNASAPSVSTEVVDVSKGIGTYYVLDRVYLNATLLLTGYYPVDGSN',
                'Q98339_9BETC': 'IGDFRCIQLVNSNGANVSAPSISTETVDVSQGLGTYYVLDRVYLNATLLLTGYYPVDGSK' },
   'branchList': [['root', 'Q9DR80_9BETC', 0.15084],
                  ['root', 'node1', 0],
                  ['node1', 'E5RPZ2_9BETC', 0.19369],
                  ['node1', 'node2', 0.15833],
                  ['node2', 'SPIKE_CVHN2', 0.26651],
                  ['node2', 'node3', 0.41031],
                  ['node3', 'Q98341_9BETC', 0.07174],
                  ['node3', 'Q98339_9BETC', 0.18547]] })

console.log (JSON.stringify (nodeProfiles, null, 2))
~~~~

---
_Source: https://npm.io/package/phylogenetic-likelihood · Machine-readable twin of the npm.io package page. Health data is recomputed on every publish._
