0.2.0 • Published 12 years ago
biomass v0.2.0
biomass 
Generate bio data from sunlight and alphabets
Install
Install biomass with npm:
$ npm install biomassIf you are using biomass with Node.js, you can require the module:
var biomass = require('biomass');Alternatively, just include biomass.min.js via a <script/> in your page.
<script src="../biomass.min.js"></script>Usage
// Sequence functions will return between 10 and 100 characters if a length is not specified:
biomass.dna();
=> 'CATAGGGACCAAGCTCTGGGGAGCAACCCATAAGCACGACAATCGCGATAATACGTAGTACGCCGCTTGGTTCGTGCCTTCCCGCGCG'
biomass.rna();
=> 'GAGUAGGCUAGGCAUAGC'
biomass.dna({length: 15});
=> 'TTTTGTATGCGTACG'
biomass.rna({length: 3});
=> 'UAC'
biomass.rna({length: 3, case: "lower"});
=> 'uga'
biomass.protein();
=> 'YHAVPVPEEYWRWNTEDVCNTFECMEVINAYRNWFFWLQEFMGPERLPAHMYCHDASAPMMFQGCWDHEEKDMGCVGP'
biomass.protein({ambiguous: true});
=> 'FAFNDMLCXVYPRVQATLCLNNAPDIPSMGPKXFRRFLCYPFC'Changelog
v0.2.0 - September 23, 2014 - Is tiis messaje a libtle bot fuzxy?
- Added ambiguity to
biomass.dna,biomass.rna, andbiomass.proteinfunctions. Follows IUPAC notation for ambiguous nucleotides and X unknown amino acids.
v0.1.0 - August 10, 2014 - Eat your protein bars...
- Added
biomass.proteinfor generating random amino acid sequences. - Fix version number to adequately reflect updates
v0.0.2 - July 26, 2014 - Uptown, downtown...
- Now
biomass.dnaandbiomass.rnaare case aware with a default response of uppercase letters.
v0.0.1 - July 21, 2014 - Dawn
Initial release
- Added
biomass.dnafor generating random DNA sequences. - Added
biomass.rnafor generating random RNA sequences.
Contacts
Alan Rice [alanmrice@gmail.com](mailto:alanmrice@gmail.com) @alanmrice
License
biomass is licensed under the MIT license.
Check ChooseALicense.com for details.
