sequence-viewer v0.2.18
neXtProt - The knowledge resource on human proteins
This is a code repository for the SIB - Swiss Institute of Bioinformatics CALIPHO group neXtProt project
neXtProt sequence viewer
The sequence viewer is a super easy javascript library to use in order to draw a protein sequence in a readable way.
Live demo: https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/index.html
Simple example: https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/simple.html
Getting Started
1) Include the library using bower or npm or simply by including the javascript sequence-viewer.js
//BOWER//
bower install sequence-viewer
//NODE//
npm install sequence-viewer
2) Specify a div in your html
<div id="sequence-viewer"></div>
3) Create an instance of Sequence in javascript and apply the render method
//For Node add before : var Sequence = require("sequence-viewer"); //
var seq = new Sequence('MALWMRLLPLLALLALWGPGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN');
// Render the sequence with or without rendering options
// (Check the interactive documentation)
seq.render('#sequence-viewer');
4) Et voila!
Note: if you choose the later approach with only the main javascript you should also include the dependencies, jquery,handlebars and bootstrap.min.css
Documentation
Check out this interactive page for a better understanding of how to use the sequence viewer and its possibilities :
Options
- Show chars per line
- Wrap lines
- Highlight
- Coverage
- Labels
- Toolbar (chars per line)
- Search
- Title
- sequenceMaxHeight
- Events
- Badge
Examples
https://search.nextprot.org/entry/NX_P01308/view/proteomics
Support
If you have any problem or suggestion please open an issue here.
Development
git clone https://github.com/calipho-sib/sequence-viewer.git
npm install
(will install the development dependencies)
bower install
(will install the browser dependencies)
...make your changes and modifications...
npm run dist
(will create the min & bundle versions in dist/)
npm run build
(will create the bundle js & css in build/ for node)
grunt bump
(will push and add a new release)
npm publish
(will publish in npm)
License
This software is licensed under the GNU GPL v2 license, quoted below.
Copyright (c) 2015, SIB Swiss Institute of Bioinformatics
9 years ago
9 years ago
9 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago
10 years ago