1.0.0 • Published 6 years ago
bloater v1.0.0
Bloater
This package contains all the best packages on npm and bunbles them one awesome bundle of awesomeness. Should not be used for production (or anything really). Made with ❤️
Features
- It was 200000 small files totalling 1.8 GB, but I had to go down to 1000 dependencies.
- It actually installs (on my machine, at least once)
- Does a lot of things during install, might or might not take over your pc
@angular-devkit/build-angular@angular/animations@angular/cli@angular/common@angular/compiler@angular/compiler-cli@angular/core@angular/forms@angular/http@angular/language-service@angular/platform-browser@angular/platform-browser-dynamic@angular/router@types/a-big-triangle@types/abbrev@types/abs@types/absolute@types/acc-wizard@types/accept-language-parser@types/accepts@types/accounting@types/ace@types/ace-diff@types/acl@types/acorn@types/actioncable@types/actions-on-google@types/activex-access@types/activex-adodb@types/activex-adox@types/activex-dao@types/activex-diskquota@types/activex-excel@types/activex-faxcomexlib@types/activex-infopath@types/activex-interop@types/activex-iwshruntimelibrary@types/activex-libreoffice@types/activex-msforms@types/activex-mshtml@types/activex-msxml2@types/activex-office@types/activex-outlook@types/activex-powerpoint@types/activex-scripting@types/activex-shdocvw@types/activex-shell@types/activex-stdole@types/activex-vbide@types/activex-wia@types/activex-word@types/adal-angular@types/add-zero@types/add2home@types/adm-zip@types/adone@types/aframe@types/agenda@types/aggregate-error@types/agora-rtc-sdk@types/ajv-errors@types/alertify@types/alexa-sdk@types/alexa-voice-service@types/algebra.js@types/algoliasearch@types/allure-js-commons@types/alt@types/amazon-cognito-auth-js@types/amazon-product-api@types/amcharts@types/amp@types/amp-message@types/amphtml-validator@types/amplify@types/amplify-deferred@types/amplitude-js@types/amqp@types/amqp-connection-manager@types/amqp-rpc@types/amqplib@types/analytics-node@types/anchor-js@types/angular@types/angular-agility@types/angular-animate@types/angular-block-ui@types/angular-bootstrap-calendar@types/angular-bootstrap-lightbox@types/angular-breadcrumb@types/angular-clipboard@types/angular-cookie@types/angular-cookies@types/angular-deferred-bootstrap@types/angular-desktop-notification@types/angular-dialog-service@types/angular-dynamic-locale@types/angular-environment@types/angular-es@types/angular-feature-flags@types/angular-file-saver@types/angular-file-upload@types/angular-formly@types/angular-fullscreen@types/angular-gettext@types/angular-google-analytics@types/angular-gridster@types/angular-growl-v2@types/angular-hotkeys@types/angular-http-auth@types/angular-httpi@types/angular-idle@types/angular-jwt@types/angular-load@types/angular-loading-bar@types/angular-local-storage@types/angular-localforage@types/angular-locker@types/angular-material@types/angular-media-queries@types/angular-meteor@types/angular-mocks@types/angular-modal@types/angular-notifications@types/angular-notify@types/angular-oauth2@types/angular-odata-resources@types/angular-pdfjs-viewer@types/angular-permission@types/angular-promise-tracker@types/angular-q-spread@types/angular-resource@types/angular-route@types/angular-sanitize@types/angular-scenario@types/angular-scroll@types/angular-signalr-hub@types/angular-spinner@types/angular-storage@types/angular-strap@types/angular-toastr@types/angular-toasty@types/angular-tooltips@types/angular-translate@types/angular-ui-bootstrap@types/angular-ui-notification@types/angular-ui-router@types/angular-ui-scroll@types/angular-ui-sortable@types/angular-ui-tree@types/angular-websocket@types/angular-wizard@types/angular-xeditable@types/angular.throttle@types/angularfire@types/angularlocalstorage@types/angulartics@types/animation-frame@types/animejs@types/annyang@types/ansi-colors@types/ansi-escapes@types/ansi-regex@types/ansi-styles@types/ansicolors@types/antlr4@types/any-db@types/any-db-transaction@types/anybar@types/anymatch@types/apex.js@types/aphrodite@types/api-error-handler@types/apicache@types/apigee-access@types/apollo-codegen@types/apollo-upload-client@types/app-root-dir@types/app-root-path@types/appdmg@types/appframework@types/applepayjs@types/appletvjs@types/applicationinsights-js@types/aqb@types/arangodb@types/arbiter@types/arcgis-js-api@types/arcgis-rest-api@types/arcgis-to-geojson-utils@types/archiver@types/archy@types/are-we-there-yet@types/forwarded@types/fossil-delta@types/foundation@types/fpsmeter@types/framebus@types/freedom@types/freeport@types/fresh@types/freshy@types/friendly-errors-webpack-plugin@types/frisby@types/from@types/from2@types/fromjs@types/fromnow@types/react-infinite-calendar@types/react-infinite-scroll-component@types/react-infinite-scroller@types/react-input-calendar@types/react-input-mask@types/react-intl@types/react-intl-redux@types/react-is@types/react-is-deprecated@types/react-joyride@types/react-js-pagination@types/react-json@types/react-json-pretty@types/react-json-tree@types/react-jsonschema-form@types/react-lazyload@types/react-lazylog@types/react-leaflet@types/react-list@types/react-loadable@types/react-loader@types/react-mailchimp-subscribe@types/react-map-gl@types/react-maskedinput@types/react-mce@types/react-mdl@types/react-measure@types/react-mixin@types/react-modal@types/react-motion@types/react-motion-slider@types/react-motion-ui-pack@types/react-native@types/react-native-android-taskdescription@types/react-native-auth0@types/react-native-autocomplete-input@types/react-native-background-timer@types/react-native-bluetooth-serial@types/react-native-communications@types/react-native-custom-tabs@types/react-native-datepicker@types/react-native-dialog@types/react-native-doc-viewer@types/react-native-document-picker@types/react-native-drawer@types/react-native-drawer-layout@types/react-native-elevated-view@types/react-native-fabric@types/react-native-fbsdk@types/react-native-fetch-blob@types/react-native-fs@types/react-native-google-signin@types/react-native-htmlview@types/react-native-i18n@types/react-native-indicators@types/react-native-keep-awake@types/react-native-keyboard-spacer@types/react-native-keychain@types/react-native-loading-spinner-overlay@types/react-native-material-design-searchbar@types/react-native-material-kit@types/react-native-material-textfield@types/react-native-material-ui@types/react-native-mixpanel@types/react-native-modalbox@types/react-native-multi-slider@types/react-native-orientation@types/react-native-permissions@types/react-native-photo-view@types/react-native-popup-dialog@types/react-native-push-notification@types/react-native-qrcode@types/react-native-safari-view@types/react-native-scrollable-tab-view@types/react-native-sensor-manager@types/react-native-settings-list@types/react-native-share@types/react-native-snap-carousel@types/react-native-sortable-grid@types/react-native-sortable-list@types/react-native-sqlite-storage@types/react-native-star-rating@types/react-native-svg-charts@types/react-native-svg-uri@types/react-native-swiper@types/react-native-tab-navigator@types/react-native-tab-view@types/react-native-text-input-mask@types/react-native-toast-native@types/react-native-touch-id@types/react-native-vector-icons@types/react-native-version-number@types/react-native-video@types/react-navigation@types/react-notification-system@types/react-notification-system-redux@types/react-notify-toast@types/react-numeric-input@types/react-onclickoutside@types/react-onsenui@types/react-overlays@types/react-owl-carousel@types/react-paginate@types/react-places-autocomplete@types/react-pointable@types/react-popover@types/react-portal@types/react-primitives@types/react-props-decorators@types/react-radio-group@types/react-recaptcha@types/react-redux@types/react-redux-epic@types/react-redux-i18n@types/react-redux-toastr@types/react-relay@types/react-resize-detector@types/react-resolver@types/react-responsive@types/react-rnd@types/react-router@types/react-router-bootstrap@types/react-router-config@types/react-router-dom@types/react-router-native@types/react-router-navigation@types/react-router-navigation-core@types/react-router-param-link@types/react-router-redux@types/react-s-alert@types/react-scroll@types/react-scrollbar@types/react-select@types/react-share@types/react-show-more@types/react-side-effect@types/react-sidebar@types/react-sketchapp@types/react-slick@types/react-slider@types/react-smooth-scrollbar@types/react-sortable-hoc@types/react-sortable-pane@types/react-sortable-tree@types/react-spinkit@types/react-sticky@types/react-sticky-el@types/react-stickynode@types/react-stripe-elements@types/react-svg@types/react-svg-inline@types/react-svg-pan-zoom@types/react-swf@types/react-swipe@types/react-swipeable@types/react-swipeable-views@types/react-syntax-highlighter@types/react-table@types/react-tabs@types/react-tag-input@types/react-tagcloud@types/react-tagsinput@types/react-tap-event-plugin@types/react-test-renderer@types/react-tether@types/react-text-mask@types/react-textarea-autosize@types/react-timeout@types/react-toastify@types/react-toastr@types/react-toggle@types/react-tooltip@types/react-touch@types/react-tracking@types/react-transition-group@types/react-treeview@types/react-truncate@types/react-twitter-auth@types/react-user-tour@types/react-virtual-keyboard@types/react-virtualized@types/react-virtualized-select@types/react-webcam@types/react-weui@types/react-widgets@types/react-widgets-moment@types/react-youtube@types/react-youtube-embed@types/reactable@types/reactcss@types/reactstrap@types/read@types/read-chunk@types/read-package-tree@types/read-pkg@types/read-pkg-up@types/readdir-enhanced@types/readdir-stream@types/readline-sync@types/readline-transform@types/reapop@types/rebass@types/recaptcha2@types/recase@types/recharts@types/recluster@types/recompose@types/reconnectingwebsocket@types/recursive-readdir@types/redis@types/redis-errors@types/redis-mock@types/redis-rate-limiter@types/redis-scripto@types/redlock@types/redom@types/reduce-reducers@types/redux-action@types/redux-action-utils@types/redux-actions@types/redux-auth-wrapper@types/redux-batched-subscribe@types/redux-debounced@types/redux-devtools@types/redux-devtools-dock-monitor@types/redux-devtools-log-monitor@types/redux-doghouse@types/redux-first-router@types/redux-first-router-link@types/redux-first-router-restore-scroll@types/redux-first-routing@types/redux-form@types/redux-immutable@types/redux-immutable-state-invariant@types/redux-infinite-scroll@types/redux-injectable-store@types/redux-little-router@types/redux-localstorage@types/redux-localstorage-debounce@types/redux-localstorage-filter@types/redux-logger@types/redux-mock-store@types/redux-optimistic-ui@types/redux-orm@types/redux-pack@types/redux-persist-transform-encrypt@types/redux-persist-transform-filter@types/redux-promise@types/redux-promise-middleware@types/redux-recycle@types/redux-router@types/redux-shortcuts@types/redux-socket.io@types/redux-storage@types/redux-storage-engine-jsurl@types/redux-storage-engine-localstorage@types/redux-test-utils@types/redux-testkit@types/redux-ui@types/ref@types/ref-array@types/ref-struct@types/ref-union@types/reflux@types/relateurl@types/relaxed-json@types/relay-runtime@types/remarkable@types/remote-redux-devtools@types/remove-markdown@types/rename@types/replace-ext@types/request@types/request-as-curl@types/request-ip@types/request-promise@types/request-promise-native@types/requestretry@types/require-dir@types/require-directory@types/require-from-string@types/require-relative@types/requirejs@types/requirejs-domready@types/resemblejs@types/reservoir@types/resolve@types/resolve-from@types/resourcejs@types/response-time@types/rest@types/restangular@types/restful.js@types/restify@types/restify-cookies@types/restify-cors-middleware@types/restify-errors@types/restify-plugins@types/restler@types/restling@types/resumablejs@types/rethinkdb@types/retry@types/retry-as-promised@types/rev-hash@types/revalidate@types/revalidator@types/reveal@types/rewire@types/rfc2047@types/rgrove__parse-xml@types/rheostat@types/rickshaw@types/rimraf@types/riot@types/riot-api-nodejs@types/riot-games-api@types/riot-route@types/riotcontrol@types/riotjs@types/rison@types/rivets@types/rmfr@types/roads@types/roads-server@types/roll@types/rolling-rate-limiter@types/rollup-plugin-json@types/ronomon__crypto-async@types/rosie@types/roslib@types/rot-js@types/route-parser@types/routie@types/royalslider@types/rpio@types/rrc@types/rsmq@types/rsmq-worker@types/rss@types/rsvp@types/rsync@types/rtree@types/run-parallel@types/run-parallel-limit@types/run-sequence@types/runes@types/rwlock@types/rword@types/rx@types/rx-angular@types/rx-core@types/rx-core-binding@types/rx-dom@types/rx-jquery@types/rx-lite@types/rx-lite-aggregates@types/rx-lite-async@types/rx-lite-backpressure@types/rx-lite-coincidence@types/rx-lite-experimental@types/rx-lite-joinpatterns@types/rx-lite-testing@types/rx-lite-time@types/rx-lite-virtualtime@types/rx-node@types/rx.wamp@types/s3-download-stream@types/s3-upload-stream@types/s3-uploader@types/s3rver@types/safari-extension@types/safari-extension-content@types/safe-compare@types/safe-json-stringify@types/safe-regex@types/sails.io.js@types/saml2-js@types/saml20@types/samlp@types/sammy@types/sanctuary@types/sandboxed-module@types/sane@types/sanitize-filename@types/sanitize-html@types/sanitizer@types/sap__xsenv@types/sass-graph@types/sass-webpack-plugin@types/sat@types/satnav@types/sax@types/saywhen@types/scalike@types/schema-registry@types/schwifty@types/scoped-http-client@types/screenfull@types/screeps@types/screeps-profiler@types/scriptjs@types/scroll-into-view@types/scroller@types/scrollreveal@types/scrolltofixed@types/scrypt-async@types/scryptsy@types/seamless@types/seamless-immutable@types/secp256k1@types/seed-random@types/seededshuffle@types/seedrandom@types/segment-analytics@types/select2@types/selectables@types/selectize@types/selenium-standalone@types/selenium-webdriver@types/semantic-ui@types/semantic-ui-accordion@types/semantic-ui-api@types/semantic-ui-checkbox@types/semantic-ui-dimmer@types/semantic-ui-dropdown@types/semantic-ui-embed@types/semantic-ui-form@types/semantic-ui-modal@types/semantic-ui-nag@types/semantic-ui-popup@types/semantic-ui-progress@types/semantic-ui-rating@types/semantic-ui-search@types/semantic-ui-shape@types/semantic-ui-sidebar@types/semantic-ui-site@types/semantic-ui-sticky@types/semantic-ui-tab@types/semantic-ui-transition@types/semantic-ui-visibility@types/semaphore@types/semver@types/semver-compare@types/semver-diff@types/semver-sort@types/sencha_touch@types/send@types/seneca@types/sequelize@types/sequelize-fixtures@types/sequencify@types/sequester@types/serialize-error@types/serialize-javascript@types/serialport@types/serve-favicon@types/serve-index@types/serve-static@types/server-destroy@types/servicenow@types/session-file-store@types/set-cookie-parser@types/set-value@types/settings@types/sha1@types/shallowequal@types/shapefile@types/sharedworker@types/sharepoint@types/sharp@types/sheetify@types/shell-escape@types/shell-quote@types/shelljs@types/shelljs-exec-proxy@types/shimmer@types/shipit@types/shipit-utils@types/shopify-buy@types/shortid@types/should-sinon@types/showdown@types/shrink-ray@types/shuffle-array@types/siema@types/siesta@types/sigmajs@types/sigmund@types/signale@types/signalr@types/signalr-no-jquery@types/signals@types/signature_pad@types/simple-assign@types/simple-cw-node@types/simple-lru@types/simple-mock@types/simple-oauth2@types/simple-peer@types/simple-url-cache@types/simple-websocket@types/simple-xml@types/simplebar@types/simplemde@types/simplesmtp@types/simplestorage.js@types/single-line-log@types/sinon@types/sinon-as-promised@types/sinon-chai@types/sinon-chrome@types/sinon-express-mock@types/sinon-mongoose@types/sinon-stub-promise@types/sinon-test@types/sip.js@types/sipml@types/sitemap2@types/six-runtime@types/sizzle@types/sjcl@types/skatejs@types/ski@types/skyway@types/slack-node@types/slack-winston@types/slackdown@types/slackify-html@types/slate@types/slate-base64-serializer@types/slate-html-serializer@types/slate-irc@types/slate-plain-serializer@types/slate-react@types/sleep@types/slick-carousel@types/slickgrid@types/slideout@types/slimerjs@types/slocket@types/slug@types/smart-fox-server@types/smoothscroll-polyfill@types/smtp-server@types/smtpapi@types/snapsvg@types/snazzy-info-window@types/snekfetch@types/snoowrap@types/snowboy@types/socket.io@types/socket.io-client@types/socket.io-parser@types/socket.io-redis@types/socket.io.users@types/socketio-jwt@types/socketio-jwt-auth@types/socketio-wildcard@types/socketty@types/sockjs@types/sockjs-client@types/solidity-parser-antlr@types/solr-client@types/solution-center-communicator@types/sort-array@types/sortablejs@types/soundjs@types/soundmanager2@types/soupbintcp@types/source-list-map@types/source-map-support@types/space-pen@types/spark-md5@types/sparkly@types/sparkpost@types/sparqljs@types/spatialite@types/spdx-correct@types/spdx-satisfies@types/spdy@types/speakeasy@types/speakingurl@types/spectacle@types/spectrum@types/split@types/split.js@types/split2@types/splunk-bunyan-logger@types/splunk-logging@types/spotify-api@types/spotify-web-playback-sdk@types/sprintf@types/sprintf-js@types/sql-bricks@types/sql.js@types/sqlite3@types/sqlstring@types/sqs-consumer@types/sqs-producer@types/squirejs@types/srp@types/ssh-key-decrypt@types/ssh2@types/ssh2-sftp-client@types/ssh2-streams@types/sshpk@types/stack-mapper@types/stack-trace@types/stack-utils@types/stacktrace-js@types/stale-lru-cache@types/stampit@types/stamplay-js-sdk@types/starwars-names@types/stat-mode@types/static-eval@types/stats.js@types/statsd-client@types/statuses@types/std-mocks@types/steam@types/steam-client@types/steam-totp@types/steamid@types/steed@types/stellar-sdk@types/stemmer@types/sticky-cluster@types/stompjs@types/stoppable@types/storejs@types/storybook__addon-a11y@types/storybook__addon-actions@types/storybook__addon-backgrounds@types/storybook__addon-info@types/storybook__addon-knobs@types/storybook__addon-links@types/storybook__addon-notes@types/storybook__addon-options@types/storybook__addon-storyshots@types/storybook__react@types/storybook__react-native@types/storybook__vue@types/stream-buffers@types/stream-chain@types/stream-csv-as-json@types/stream-json@types/stream-meter@types/stream-series@types/stream-shift@types/stream-to-array@types/stream-to-promise@types/streaming-json-stringify@types/streamjs@types/streamtest@types/strftime@types/strict-uri-encode@types/string@types/string-hash@types/string-similarity@types/string-template@types/string-width@types/string_score@types/stringify-object@types/strip-ansi@types/strip-bom@types/stripe@types/stripe-checkout@types/stripe-v2@types/stripe-v3amazeuiangularantdantd-mobileasyncaurelia-frameworkavababelbluebirdbody-parserbootstrapbootstrap-material-designbootstrap-material-design-communitybowerbrowserifybulmachaichalkcodelyzercommanderconnectcore-jscost-of-modulescroppercropperjsdebugdo-deploydocumentationdvaeggemberember-cliember-sourceeslintexpressfastifyforeverfueluxgenerator-angulargenerator-karmagenerator-react-fullstackgentelellagit-http-backendgraphqlgray-matterhapihyperappinfernoiviewjasmine-corejasmine-spec-reporterjscsjsdocjsdomkarmakarma-chrome-launcherkarma-coverage-istanbul-reporterkarma-jasminekarma-jasmine-html-reporterkoaleft-padlesslive-serverlodashmarkedmarketcloud-nodemarkometro-uimilligrammochamomentmongodbmongoosenano-sqlnode-pnglibnode-rednode-ssdppgphonegappm2prismaprotractorreactreact-domreact-starterreact-styleguidistrequestrestifyriotronnrxjssassserialportserverlesssocket.iospectre.csssqlstringstatsdstylussvn-repository-providertabler-uiterrible-lodashtotal.jsts-nodetsdoctslinttypescriptuglify-jsunderscoreversion-treeviewerjsvuevue-js-modalvuejsvuepresswebpackwebscaledbyozone.js