2.28.4 • Published 3 months ago

project-wajs-dv v2.28.4

Weekly downloads
-
License
Apache-2.0
Repository
-
Last release
3 months ago

WPPConnect/WA-JS

npm version Downloads Average time to resolve an issue Percentage of issues still open

Build Status Build Status Lint Status release-it

WPPConnect/WA-JS is an open-source project with the aim of exporting functions from WhatsApp Web, which can be used to support the creation of any interaction, such as customer service, media sending, intelligence recognition based on phrases artificial and many other things, use your imagination...

Our online channels

Discord Telegram Group WhatsApp Group YouTube

How does it work

This project extract some functions of WhatsApp sources, that uses webpack.

After build, this project generate a file dist/wppconnect-wa.js to be used for injection in WhatsApp Web. When injected, it will explose a global variable named WPP.

Some parts of WPP variable:

  • WPP.webpack - Scripts to exports WhatsApp functions.
  • WPP.whatsapp - Only exported WhatsApp functions.
  • WPP.chat - Chat functions and events.
  • ...

Exported WhatsApp modules

There are a convection name for some exported modules:

  • ...Model - Class for data structure (ClassModel, MsgModel)
  • ...Collection - Class for collection of models (ChatCollection, MsgCollection)
  • ...Store - Default and global instance of a collection (ChatStore, MsgStore)

Development

Steps to run locally:

# install the depencencies
npm install

# download whatsapp javascript and prettify (optional)
npm run wa-source

# build javascript files
npm run build:prd # or build:dev for development

# lauch a local browser with automatic injection
npm run launch:local

# or only run in VSCode

How to use this project

Basicaly, you need to inject the wppconnect-wa.js file into the browser after WhatsApp page load.

TamperMonkey or GreaseMonkey

// ==UserScript==
// @name         WA-JS Teste
// @namespace    http://tampermonkey.net/
// @version      0.1
// @description  Simple example of WA-JS
// @author       You
// @match        https://web.whatsapp.com/*
// @icon         https://www.google.com/s2/favicons?domain=whatsapp.com
// @require      https://github.com/wppconnect-team/wa-js/releases/download/nightly/wppconnect-wa.js
// @grant        none
// ==/UserScript==

/* globals WPP */

(function () {
  'use strict';

  WPP.webpack.onReady(function () {
    alert('Ready to use WPPConnect WA-JS');
  });

  // Your code here...
})();

Playwright

import * as playwright from 'playwright-chromium';

async function start() {
  const browser = await playwright.chromium.launch();
  const page = browser.newPage();

  await page.goto('https://web.whatsapp.com/');

  await page.addScriptTag({
    path: require.resolve('@wppconnect/wa-js'),
  });

  // Wait WA-JS load
  await page.waitForFunction(() => window.WPP?.isReady);

  // Evaluating code: See https://playwright.dev/docs/evaluating/
  const isAuthenticated: string = await page.evaluate(() =>
    WPP.auth.isAuthenticated()
  );

  // Sending message: See https://playwright.dev/docs/evaluating/
  const sendResult: string = await page.evaluate(
    (to, message) => WPP.chat.sendTextMessage(to, message),
    to,
    message
  );
}

start();

License

Copyright 2021 WPPConnect Team

Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at

http://www.apache.org/licenses/LICENSE-2.0

Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.

acornacorn-import-assertionsacorn-jsxacorn-walkadd-streamagent-baseajvajv-keywordsansi-alignansi-escapesansi-regexansi-sequence-parseransi-stylesargargparsearray-buffer-byte-lengtharray-ifyarray-includesarray-unionarray.prototype.findlastindexarray.prototype.flatarray.prototype.flatmaparray.prototype.maparraybuffer.prototype.slicearrifyast-typesasync-retryasynckitavailable-typed-arraysbalanced-matchbase64-jsbasic-ftpbefore-after-hookblblueimp-canvas-to-blobboxenbrace-expansionbracesbrowserslistbuffer-frombundle-namecacheable-lookupcacheable-requestcall-bindcallsitescamelcasecamelcase-keyscaniuse-litechalkchardetchrome-trace-eventci-infocli-boxescli-cursorcli-spinnerscli-truncatecli-widthcliuicloneclone-deepcode-block-writercolor-convertcolor-namecolorettecombined-streamcommandercompare-funcconcat-mapconfig-chainconfigstoreconventional-changelogconventional-changelog-atomconventional-changelog-codemirrorconventional-changelog-conventionalcommitsconventional-changelog-coreconventional-changelog-emberconventional-changelog-eslintconventional-changelog-expressconventional-changelog-jqueryconventional-changelog-jshintconventional-changelog-preset-loaderconventional-changelog-writerconventional-commits-filterconventional-commits-parsercosmiconfigcosmiconfig-typescript-loadercreate-requirecross-spawncrypto-random-stringdargsdata-uri-to-bufferdecamelizedecamelize-keysdecompress-responsedeep-extenddeep-isdefault-browserdefault-browser-iddefaultsdefer-to-connectdefine-data-propertydefine-lazy-propdefine-propertiesdegeneratordelayed-streamdeprecationdiffdir-globdoctrinedot-propeastasianwidthelectron-to-chromiumemoji-regexenhanced-resolveenv-pathsenvinfoerror-exes-abstractes-array-method-boxes-properlyes-get-iteratores-module-lexeres-set-tostringtages-shim-unscopableses-to-primitiveescaladeescape-goatescape-string-regexpescodegeneslint-import-resolver-nodeeslint-module-utilseslint-scopeeslint-visitor-keysespreeesprimaesqueryesrecurseestraverseesutilseventemitter3eventsexecaexternal-editorfast-deep-equalfast-difffast-globfast-json-stable-stringifyfast-levenshteinfastest-levenshteinfastqfetch-blobfiguresfile-entry-cachefill-rangefind-upflatflat-cacheflattedfor-eachform-dataform-data-encoderformdata-polyfillfs-extrafs.realpathfunction-bindfunction.prototype.namefunctions-have-namesget-caller-fileget-east-asian-widthget-intrinsicget-streamget-symbol-descriptionget-urigit-raw-commitsgit-semver-tagsgit-upgit-url-parseglobglob-parentglob-to-regexpglobal-dirsglobalsglobalthisglobbygopdgotgraceful-fsgraphemerhandlebarshard-rejectionhas-bigintshas-flaghas-property-descriptorshas-protohas-symbolshas-tostringtaghasownhosted-git-infohttp-cache-semanticshttp-proxy-agenthttp2-wrapperhttps-proxy-agenthuman-signalsiconv-liteieee754ignoreimport-freshimport-lazyimport-localimurmurhashindent-stringinflightinheritsiniinquirerinternal-slotinterpretipis-argumentsis-array-bufferis-arrayishis-bigintis-blobis-boolean-objectis-callableis-ciis-core-moduleis-date-objectis-dockeris-extglobis-fullwidth-code-pointis-globis-in-ciis-inside-containeris-installed-globallyis-interactiveis-mapis-negative-zerois-npmis-numberis-number-objectis-objis-path-insideis-plain-objis-plain-objectis-regexis-setis-shared-array-bufferis-sshis-streamis-stringis-symbolis-text-pathis-typed-arrayis-typedarrayis-unicode-supportedis-weakrefis-wslisarrayisexeisobjectissue-parseriterate-iteratoriterate-valuejest-workerjitijs-tokensjs-yamljson-bufferjson-parse-even-better-errorsjson-schema-traversejson-stable-stringify-without-jsonifyjson-stringify-safejson5jsonc-parserjsonfilejsonparseJSONStreamkeyvkind-oflatest-versionlevnlilconfiglines-and-columnslistr2loader-runnerlocate-pathlodashlodash.camelcaselodash.capitalizelodash.escaperegexplodash.isfunctionlodash.isplainobjectlodash.isstringlodash.kebabcaselodash.mergelodash.mergewithlodash.snakecaselodash.startcaselodash.uniqlodash.uniqbylodash.upperfirstlog-symbolslog-updatelowercase-keyslru-cachelunrmacos-releasemake-errormap-objmarkedmeowmerge-streammerge2micromatchmime-dbmime-typesmimic-fnmimic-responsemin-indentminimatchminimistminimist-optionsmkdirpmsmute-streamnatural-compareneo-asyncnetmasknew-github-release-urlnode-domexceptionnode-releasesnormalize-package-datanormalize-urlnpm-run-pathobject-inspectobject-keysobject.assignobject.fromentriesobject.groupbyobject.valuesonceonetimeopenoptionatororaos-nameos-tmpdirp-cancelablep-limitp-locatep-trypac-proxy-agentpac-resolverpackage-jsonparent-moduleparse-jsonparse-pathparse-urlpath-browserifypath-existspath-is-absolutepath-keypath-parsepath-typepeek-readablepicocolorspicomatchpidtreepkg-dirplaywrightplaywright-coreprelude-lsprettier-linter-helperspromise.allsettledproto-listprotocolsproxy-agentproxy-from-envpunycodepupaqueue-microtaskquick-lrurandombytesrcread-pkgread-pkg-upreadable-streamreadable-web-to-node-streamrechoirredentregexp.prototype.flagsregistry-auth-tokenregistry-urlrequire-directoryrequire-from-stringresolveresolve-alpnresolve-cwdresolve-fromresolve-globalresponselikerestore-cursorretryreusifyrfdcrimrafrun-applescriptrun-asyncrun-parallelrxjssafe-array-concatsafe-buffersafe-regex-testsafer-bufferschema-utilssemversemver-diffserialize-javascriptset-function-lengthset-function-nameshallow-cloneshebang-commandshebang-regexshelljsshikiside-channelsignal-exitslashslice-ansismart-buffersockssocks-proxy-agentsource-mapsource-map-supportspdx-correctspdx-exceptionsspdx-expression-parsespdx-license-idssplit2stdin-discarderstop-iteration-iteratorstring-argvstring-widthstring.prototype.trimstring.prototype.trimendstring.prototype.trimstartstring_decoderstrip-ansistrip-bomstrip-final-newlinestrip-indentstrip-json-commentsstrtok3supports-colorsupports-preserve-symlinks-flagsynckittapabletemp-dirtempfileterserterser-webpack-plugintext-extensionstext-tablethroughthrough2tmpto-regex-rangetoken-typestr46trim-newlinests-api-utilstsconfig-pathstslibtype-checktype-festtyped-array-buffertyped-array-byte-lengthtyped-array-byte-offsettyped-array-lengthtypedarray-to-bufferuglify-jsunbox-primitiveundici-typesunicorn-magicunique-stringuniversal-user-agentuniversalifyupdate-browserslist-dbupdate-notifieruri-jsurl-joinutil-deprecatev8-compile-cache-libvalid-data-urlvalidate-npm-package-licensevscode-onigurumavscode-textmatewatchpackwcwidthweb-streams-polyfillwebidl-conversionswebpack-mergewebpack-sourceswhatwg-urlwhichwhich-boxed-primitivewhich-typed-arraywidest-linewildcardwildcard-matchwindows-releasewordwrapwrap-ansiwrappywrite-file-atomicxdg-basediry18nyallistyamlyargsyargs-parserynyocto-queue
2.28.4

3 months ago

2.28.3

3 months ago

2.28.2

3 months ago

2.28.1

3 months ago